Galanin (1-29) (rat, mouse)
About this Product
- SKU:
- GA-030
- Additional Names:
- 114547-31-8, GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, Galanin (1-29) (rat, mouse)
- CAS Number:
- 114547-31-8
- Extra Details:
- Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Ki values of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Galanin (1-29) (rat, mouse) is an anticonvulsant which can prevent the occurrence of full kindled seizures in rats. Galanin (1-29) (rat, mouse) causes orexigenic effects in a variety of species.
- Immunogen:
- Galanin receptors
- Molecular Weight:
- 3164.48
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Fisone et al (1989) Galanin receptor and its ligands in the rat hippocampus. Eur J Biochem. <strong>181</strong>(1) 269 <a href="https://pubmed.ncbi.nlm.nih.gov/2469577/" target="_blank" rel="nofollow">PMID: 2469577</a></p><p>Mazarati et al (2006) Regulation of kindling epileptogenesis by hippocampal galanin type 1 and type 2 receptors: The effects of subtype-selective agonists and the role of G-protein-mediated signaling. J Pharmacol Exp Ther. 318(2) 700 <a href="https://pubmed.ncbi.nlm.nih.gov/16699066/" target="_blank" rel="nofollow">PMID: 16699066</a><br></p><p>Serebryakova et al (2019) Galanin and its N-terminal fragments reduce acute myocardial infarction in rats. Peptides <strong>111</strong> 127 <a href="https://pubmed.ncbi.nlm.nih.gov/29730241/" target="_blank">PMID: 29730241</a></p>
- Sequence:
- H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1 mg/ml in water
- Formula:
- C141H211N43O41
