Galanin (human)
About this Product
- SKU:
- GA-020
- Additional Names:
- Galanin (1-30) (human)|Galanin (human), GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS, 119418-04-1
- CAS Number:
- 119418-04-1
- Extra Details:
- Galanin (human) is an endogenous peptide with high affinity for all three galanin receptors and multiple endocrine, metabolic and behavioural effects. Named galanin after its N-terminal glycine and its C-terminal alanine, galanin (human) is widely expressed in the central and peripheral nervous system as well as in the endocrine system and co-exists with a number of classical neurotransmitters. Galanin (human) is also linked to cognitive deficits in Alzheimer's disease.
- Immunogen:
- Galanin receptors
- Molecular Weight:
- 3155.55
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Schmidt et al (1991) Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. <strong>88</strong> 11435 PMID: 1722333</p><p>Webling et al (2012) Galanin Receptors and Ligands. Front. Endocrinology <strong>3</strong> 146 https://www.frontiersin.org/article/10.3389/fendo.2012.00146</p><p>Volpe et al (2020) Is Galanin a Promising Therapeutic Resource for Neural and Nonneural Diseases? Current Drug Targets <strong>21(</strong>9) 922 https://doi.org/10.2174/1389450121666200225112055 <br></p>
- Sequence:
- H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 0.50 mg/ml in water
- Formula:
- C139H210N42O43
