SFKEELDKYFKNHTSP
About this Product
- SKU:
- EP-020
- Additional Names:
- EP-020, SFKEELDKYFKNHTSP, 1147SFKEELDKYFKNHTSP1162, truncated P4|truncated P4, 1147SFKEELDKYFKNHTSP1162
- Extra Details:
- SFKEELDKYFKNHTSP is a truncated peptide derived from the P4 peptide of the S2 subunit of the S protein of SARS-CoV-2 which has the the amino acid sequence DPLQPELDSFKEELDKYFKNHTSPDVDLGDIS, corresponding to residues 1139-1170. The P4 peptide is located in the linker region between heptad repeat 1 (HR1) and heptad repeat 2 (HR2) and is highly conserved among SARS-CoV, BatCoV RaTG13, SARS-CoV-2 and recent SARS-CoV-2 variants. Antibodies targeting the peptide SFKEELDKYFKNHTSP can neutralize both SARS-CoV-2 and SARS-CoV by preventing fusion between the virus and the cell membrane.
- Immunogen:
- Antivirals,Epitopes
- Molecular Weight:
- 1970.16
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Li et al (2021) A novel linear and broadly neutralizing peptide in the SARS-CoV-2 S2 protein for universal vaccine development. Cell Mol Immunol. <strong>18</strong>(11) 2563 PMID: 34645942
- Sequence:
- H-Ser-Phe-Lys-Glu-Glu-Leu-Asp-Lys-Tyr-Phe-Lys-Asn-His-Thr-Ser-Pro-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C90 H132N22O28
