P9R
About this Product
- SKU:
- CV-060
- Additional Names:
- P9R, defensin, peptide, antiviral activity, avian influenza, coronavirus, SARS-CoV-2, MERS-CoV , SARS-CoV, rhinovirus, NGAICWGPCPTAFRQIGNCGRFRVRCCRIR, CV-060, CV060
- Extra Details:
- P9R is a defensin-like peptide that exhibits potent antiviral activity against pH-dependent viruses, including the avian influenza A(H7N9) virus, coronaviruses (SARS-CoV-2, MERS-CoV and SARS-CoV), and the non-enveloped rhinovirus. The antiviral activity of P9R depends on direct binding to viruses and inhibition of virus-host endosomal acidification but when P9R was added to cells after SARS-CoV-2 infection, P9R could significantly inhibit viral replication. P9R can also protect mice in lethal challenge models.
- Immunogen:
- Antivirals
- Molecular Weight:
- 3412.1
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Zhao et al (2020) A broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2. Nat Commun.<strong> 11</strong> 4252 https://doi.org/10.1038/s41467-020-17986-9
- Sequence:
- H-Asn-Gly-Ala-Ile-Cys-Trp-Gly-Pro-Cys-Pro-Thr-Ala-Phe-Arg-Gln-Ile-Gly-Asn-Cys-Gly-Arg-Phe-Arg-Val-Arg-Cys-Cys-Arg-Ile-Arg-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- >95% by HPLC
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 5 mg/ml in water
- Formula:
- C144H232N52O35S5
