CRF (human, rat)
About this Product
- SKU:
- CR-020
- Additional Names:
- Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH|CRF (human, rat), CR-020, CR020, Corticotropin Releasing Factor (human, rat), SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, 86784-80-7
- CAS Number:
- 86784-80-7
- Extra Details:
- CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression. Increased CRF (human, rat) production is also associated with Alzheimer's disease.
- Immunogen:
- Corticotropin releasing factor receptors
- Molecular Weight:
- 4757.51
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Vale et al (1981) Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. Science. <strong>213</strong>(4514) 1394 <a href="https://pubmed.ncbi.nlm.nih.gov/6267699/" target="_blank" rel="nofollow">PMID: 6267699</a></p><p>Ohmura and Yoshioka (2008) The roles of corticotropin releasing factor (CRF) in responses to emotional stress: is CRF release a cause or result of fear/anxiety? CNS Neurol Disord Drug Targets. <strong>8</strong>(6) 459 <a href="https://pubmed.ncbi.nlm.nih.gov/19811447/" target="_blank" rel="nofollow">PMID: 19811447</a></p><p>Jiang et al (2019) Role of Corticotropin Releasing Factor in the Neuroimmune Mechanisms of Depression: Examination of Current Pharmaceutical and Herbal Therapies. Front Cell Neurosci. <strong>13</strong> 290 <a href="https://pubmed.ncbi.nlm.nih.gov/31312123/" target="_blank" rel="nofollow">PMID: 31312123</a><br></p>
- Sequence:
- H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1.10 mg/ml in water
- Formula:
- C208H344N60O63S2
