NT1-20
About this Product
- SKU:
- AS-010
- Additional Names:
- AS-010, NT1-20, GRKKRRQRRRCMELKTEEEEVGGVQPVSIQA, NT1-20|Peptide NT1-20
- Extra Details:
- NT1-20 is a tatylated membrane penetrating peptide derived from the N-terminus of the acid sensing ion channel 1a (ASIC1a), which can block ASIC1a binding receptor interacting protein kinase 1 (RIPK1) to its C terminus. ASIC1a mediates necroptosis via recruiting RIPK1, independent of its ion-conducting function, and though this mechanism NT1-20 can protect neurons against acidosis induced necroptosis in vitro. NT1-20 can also reduce neuronal damage in mouse models of ischemic stroke.
- Immunogen:
- Protein-protein interactions,Kinases,Acid sensing ion channels
- Molecular Weight:
- 3655.22
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Wang et al (2020) Disruption of auto-inhibition underlies conformational signaling of ASIC1a to induce neuronal necroptosis. Nat Commun. <strong>11</strong>(1) 475 <a href="https://pubmed.ncbi.nlm.nih.gov/31980622/" target="_blank">PMID: 31980622</a>
- Sequence:
- H-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Met-Glu-Leu-Lys-Thr-Glu-Glu-Glu-Glu-Val-Gly-Gly-Val-Gln-Pro-Val-Ser-Ile-Gln-Ala-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C150H265N55O47S2
