Cecropin B
About this Product
- SKU:
- AM-081
- Additional Names:
- H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2, 80451-05-4, Cecropin B, antimicrobial, AMP
- CAS Number:
- 80451-05-4
- Extra Details:
- Cecropin B is a natural linear cationic A Alpha-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects.
- Immunogen:
- Antibacterials,Antifungals
- Molecular Weight:
- 3834.7
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kulagina et al (2007) Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B Chem. <strong>121</strong>(1) 150 <a href="https://pubmed.ncbi.nlm.nih.gov/18231571/" target="_blank" rel="nofollow">PMID: 18231571</a></p><p>Hu et al (2013) Broad activity against porcine bacterial pathogens displayed by two insect antimicrobial peptides moricin and cecropin B. Mol. Cells <strong>35</strong>(2) 106 <a href="https://pubmed.ncbi.nlm.nih.gov/23456332/" target="_blank" rel="nofollow">PMID: 23456332</a></p><p>Yu et al (2016) Combination Effects of Antimicrobial Peptides. Antimicrob. Agents and Chemother. <strong>60</strong> (3) 1717 <a href="https://pubmed.ncbi.nlm.nih.gov/26729502/" target="_blank" rel="nofollow">PMID: 26729502</a></p>
- Sequence:
- H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C176H302N52O41S
