mCRAMP (mouse)
About this Product
- SKU:
- AM-040
- Additional Names:
- H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin, antimicrobial activity, AM-040, AM040|Mouse calethicidin related antimicrobial peptide
- Extra Details:
- mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.
- Immunogen:
- Antibacterials,Antivirals
- Molecular Weight:
- 3878.7
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Gupta et al (2015) Short, Synthetic Cationic Peptides Have Antibacterial Activity against Mycobacterium smegmatis by Forming Pores in Membrane and Synergizing with Antibiotics. Antibiotics <strong>4</strong>(3) 358 https://doi.org/10.3390/antibiotics4030358 </p><p>Yoo et al (2015) Antifibrogenic Effects of the Antimicrobial Peptide Cathelicidin in Murine Colitis-Associated Fibrosis. CMGH Cellular and Molecular Gastroenterology and Hepatology. <strong>1</strong>(1) 55 https://doi.org/10.1016/j.jcmgh.2014.08.001 </p><p>Singh et al (2013) The human antimicrobial peptide LL-37, but not the mouse ortholog, mCRAMP, can stimulate signaling by poly(I:C) through a FPRL1-dependent pathway. J. Biol. Chem. <strong>288</strong>(12) 8258 doi:10.1074/jbc.M112.440883</p>
- Sequence:
- H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and desiccated
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid and physiological buffers
- Formula:
- C178H302N50O46
