LL 37 (human), 5-FAM
Product Sizes
0.1 mg
£118.00
AM-004-0.1MG
About this Product
- SKU:
- AM-004
- Additional Names:
- [LL-37, 37 aa], LL 37 (human), 5-FAM , carboxyfluoresceinated, host defence peptide LL 37, fluorescent detection, LL37, AM-004, AM004
- Conjugate:
- 5-Carboxyfluorescein
- Extra Details:
- LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fluorescent detection of LL 37. We also offer unlabelled LL 37 (AM-001) and the biotinylated version of LL 37 (AM-003).
- Immunogen:
- Antibacterials
- Molecular Weight:
- 4963.6
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. <strong>191</strong>(10) 4895 https://doi.org/10.4049/jimmunol.1302005 </p><p>Bandurska et al (2015) Unique features of human cathelicidin LL-37. BioFactors <strong>41</strong> 289 doi:10.1002/biof.1225 </p><p>Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. <strong>47</strong> 1060 doi: 10.1159/000490183</p>
- Sequence:
- 5-FAM-Ahx-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dark, frozen and desiccated
- Size:
- 0.1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C226H351N61O58
