LL 37 (human) biotinylated
About this Product
- SKU:
- AM-003
- Additional Names:
- [LL-37, 37 aa], LL 37 (human) biotinylated, N-terminally biotinylated, host defence, 6-carbon spacer, 6-aminohexanoic acid, Ahx, biotin tag , LL37 (human) biotinylated, AM-003, AM003
- Conjugate:
- Biotin
- Extra Details:
- LL 37 (human) biotinylated is the N-terminally biotinylated version of the host defence peptide LL 37. The biotin group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the biotin tag allows numerous biochemical and microbiological applications. We also offer unlabelled LL 37 (AM-001) and the carboxyfluoresceinated version of LL 37 (AM-004).
- Immunogen:
- Antibacterials
- Molecular Weight:
- 4832.5
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Nuding et al (2013) Gastric Antimicrobial Peptides Fail to Eradicate Helicobacter pylori Infection Due to Selective Induction and Resistance. PLoS ONE <strong>8</strong>(9) e73867 https://doi.org/10.1371/journal.pone.0073867
- Sequence:
- Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dark, frozen and desiccated.
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C221H366N64O55S
