LL 37 (human) scrambled
About this Product
- SKU:
- AM-002
- Additional Names:
- GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, LL 37, host defence peptide, human cathelicidin antimicrobial peptide (CAMP, hCAP18), LL 37 (human) scrambled, control , LL37, AM-002, AM002
- Extra Details:
- LL 37, a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. LL 37 (human) scrambled is the control peptide for LL-37 [AM-001].
- Immunogen:
- Antibacterials
- Molecular Weight:
- 4493.3
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. <strong>191</strong>(10) 4895 https://doi.org/10.4049/jimmunol.1302005 </p><p>Bandurska et al (2015) Unique features of human cathelicidin LL-37. BioFactors <strong>41</strong> 289 doi:10.1002/biof.1225 </p><p>Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem.<strong> 47 </strong>1060 doi: 10.1159/000490183</p>
- Sequence:
- H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, dark and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C205H341N61O52
