LL 37 (human)
About this Product
- SKU:
- AM-001
- Additional Names:
- H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, [LL-37, 37 aa], 154947-66-7, LL 37, human cathelicidin antimicrobial peptide, CAMP, hCAP18, antimicrobial, antiviral, immunomodulatory, chemotaxis, wound closure, angiogenesis, autoimmune and inflammatory diseases, atherosclerosis, AM-001, AM001, LL37, Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human)|Ropocamptide, hCAP 18, Cathelicidin, LL 37, LL-37, cathelicidin, LL 37 (human)
- CAS Number:
- 154947-66-7
- Extra Details:
- LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to AB Beta42, LL 37 (human) expression impacts initiation and progression of Alzheimer's disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.
- Immunogen:
- Antibacterials,Antivirals
- Molecular Weight:
- 4493.3
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kahlenberg and Kaplan (2013) Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol. <strong>191</strong>(10) 4895 <a href="https://pubmed.ncbi.nlm.nih.gov/24185823/" target="_blank" rel="nofollow">PMID: 24185823</a></p><p>Bandurska et al (2015) Unique features of human cathelicidin LL-37. BioFactors <strong>41 </strong>289 <a href="https://pubmed.ncbi.nlm.nih.gov/26434733/" target="_blank" rel="nofollow">PMID: 26434733</a></p><p>Chen et al (2018) Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer. Cell Physiol.Biochem. <strong>47</strong> 1060 <a href="https://pubmed.ncbi.nlm.nih.gov/29843147/" target="_blank" rel="nofollow">PMID: 29843147</a></p><p>Vierthaler et al (2020) Fluctuating role of antimicrobial peptide hCAP18/LL-37 in oral tongue dysplasia and carcinoma. Oncol. Rep. <strong>44</strong> 325 <a href="https://pubmed.ncbi.nlm.nih.gov/32627035/" target="_blank" rel="nofollow">PMID: 32627035</a></p><p><a href="https://www.guidetopharmacology.org/GRAC/LigandDisplayForward?ligandId=5527" target="_blank" rel="nofollow">Guide to Pharmacology - LL 37</a><br></p>
- Sequence:
- H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, dark and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in physiological buffers including PBS (>1mg/mL). Soluble in DMSO as a stock
- Formula:
- C205H341N61O52
