sfTSLP (60 aa peptide)
Product Sizes
0.1 mg
£283.00
AB-020-0.1MG
About this Product
- SKU:
- AB-020
- Additional Names:
- sfTSLP (60 aa peptide), MKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ, sfTSLP (60 aa peptide), AB-020, AB020
- Extra Details:
- sfTSLP (60 aa peptide) is an antibacterial peptide derived as the 60 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth factor produced by a thymic stromal cell line. Two transcript variants of human TSLP are described: a long form of TSLP (lfTSLP, variant 1) and an alternative, short form (sfTSLP, variant 2). The sequence of sfTSLP has two potential starting methionines that can give rise to either a 63 or a 60aa peptide. Compared with lfTSLP, sfTSLP possesses stronger antibacterial activity and appears to act as an antimicrobial peptide in the oral cavity and on the skin to create a defense barrier that aids in the control microbes.
- Immunogen:
- Antibacterials
- Molecular Weight:
- 7076.41
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Bjerkan et al (2015) The short form of TSLP is constitutively translated in human keratinocytes and has characteristics of an antimicrobial peptide. Mucosal Immunol <strong>8</strong> 49 https://doi.org/10.1038/mi.2014.41
- Sequence:
- H-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 0.1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Formula:
- C310H520N98O83S4
