Recombinant Mouse IL-1 beta
Product Sizes
5 ug
£261.00
6489-5UG
About this Product
- SKU:
- 6489
- CE/IVD:
- RUO
- Extra Details:
- IL-1 beta (IL-1B Beta) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast., ICT
- Format:
- Recombinant proteins produced in yeast
- Molecular Weight:
- 17.4 kDa
- Physical State:
- Lyophilized
- Sequence:
- VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins


