Calmodulin Kinase II Inhibitor (281-309)

Product Sizes

1 mg

£436.00

ECH-893-40-1MG

About this Product

SKU:: ECH-893-40
Extra Details:: Molecular Weight: 3371.86 \nSalt Form: Acetate \nPurity: >96% \nSequence (3-letter): Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH \nSequence (1-letter): MHRQETVDCLKKFNARRKLKGAILTTMLA-OH \nStorage: -20 ?C or below \n \nCalmodulin Kinase II Inhibitor (281-309) [CaMKII(281-309)] is a peptide fragment containing the calmodulin binding site (290-309) and the phosphorylation site (Thr286). CaMKII(281-309). It is useful as a calmodulin binding peptide and can act as an inhibitor of CaM kinase II (IC50?= 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site. Alternative name: Calmodulin Dependent Protein Kinase II (281-309) \nReferences \nWaxham MN, Aronowski J (1993) "Ca2+/calmodulin-dependent protein kinase II is phosphorylated by protein kinase C in vitro". Biochemistry 32(11):2923-30, Echelon
Molecular Weight:: 3371.86
Sequence:: Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket