Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Beta Amyloid (1-42), rat

Product Sizes
0.5 mg
£523.00
ECH-642-15-0.5MG
1 mg
£828.00
ECH-642-15-1MG
About this Product
SKU:
ECH-642-15
CAS Number:
166090-74-0
Extra Details:
CAS Number: 166090-74-0 \nMolecular Weight: 4415.26 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH \nSequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH \nStorage: -20 ?C or below \nSolubility: water 1 mg/ml \n \nBeta Amyloid (1-42), rat is the rat form of the predominant Beta amyloid peptide found in plaques associated with Alzheimer?s disease. It is homologous with the mouse peptide. In some animal models, cognitive impairment and neurodegenerative disorders that mimic Alzheimer's disease can be reproduced by intracerebral or intracerebroventricular administration of beta amyloid peptide. Evidence suggests that oxidative stresses are involved in the mechanism of beta amyloid-induced neurotoxicity and Alzheimer?s disease pathogenesis. Exposure to beta amyloid increases lipid peroxidation, protein oxidation, and the formation of hydrogen peroxide in cultured cells. Beta amyloid peptides are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in Alzheimer?s disease and neurodegeneration. \nReferences \n1. Glenner, G.G. and Wong, C.W. (1984) ?Alzheimer's disease: initial report of the purification and characterization of a novel cerebrovascular amyloid protein.? Biochem. Biophys. Res. Comm. 120: 885. \n2. Hong, L. et al (2010) ?Quantification of the binding properties of Cu2+ to the amyloid beta peptide: coordination spheres for human and rat peptides and implication on Cu2+-induced aggregation? J. Phys. Chem. 114(34): 11261-11271., Echelon
Molecular Weight:
4415.26
Sequence:
Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH \n
Shipping Conditions:
Ambient
Storage Conditions:
-20[o]C
Supplier:
Echelon Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides