Corticotropin Releasing Factor (CRF) human, rat
Product Sizes
0.5 mg
£427.00
ECH-351-25-0.5MG
1 mg
£655.00
ECH-351-25-1MG
About this Product
- SKU:
- ECH-351-25
- CAS Number:
- 86784-80-7
- Extra Details:
- CAS Number: 86784-80-7 \nMolecular Weight: 4754.52 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 \nSequence (1-letter): SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 \nStorage: -20 ?C or below \n \nCorticotropin releasing factor (CRF) is a peptide hormone involved in the stress response that stimulates pituitary synthesis of ACTH, as part of the HPA Axis., Echelon
- Molecular Weight:
- 4754.52
- Sequence:
- Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 \n
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Supplier:
- Echelon Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:https://www.echelon-inc.com/product/crf-human-rat-corticotropin-releasing-factor/


