Adrenomedullin (11-50), rat

Product Sizes

0.5 mg

£578.00

ECH-335-80-0.5MG

1 mg

£938.00

ECH-335-80-1MG

About this Product

SKU:: ECH-335-80
CAS Number:: 163648-32-6
Extra Details:: CAS Number: 163648-32-6 \nMolecular Weight: 4520.17 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 \nSequence (1-letter): STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 \nStorage: -20 ?C or below \n \nAdrenomedullin (11-50) in the active C-terminal fragment of rat adrenomedullin. Adrenomedullin is thought to be a vasodilator and is found in high concentrations in the blood. It also stimulates angiogenesis and increases cellular tolerance to hypoxic injury and oxidative stress., Echelon
Molecular Weight:: 4520.17
Sequence:: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket