Beta Endorphin, human / Beta Lipotropin (61-91), human

Product Sizes

1 mg

£229.00

ECH-291-25-1MG

5 mg

£631.00

ECH-291-25-5MG

About this Product

SKU:: ECH-291-25
CAS Number:: 61214-51-5
Extra Details:: CAS Number: 61214-51-5 \nMolecular Weight: 3462.82 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH \nSequence (1-letter): YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH \nStorage: -20 ?C or below \n \nBeta Endorphin is an endogenous neuropeptide which acts as an agonist for opioid receptors. It binds strongly to ? receptors in brain and by ? and ? receptors in the spinal cord. Beta Endorphin is released in response to painful stimuli and is studied for its effects on pain perception (nociception). It is found in the hypothalmus and pituitary gland and is formed by cleavage of the C-terminal region of ?-lipotropin., Echelon
Molecular Weight:: 3462.82
Sequence:: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket