Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin)

Product Sizes

0.5 mg

£304.00

ECH-274-56-0.5MG

1 mg

£427.00

ECH-274-56-1MG

About this Product

SKU:: ECH-274-56
Extra Details:: Molecular Weight: 3525.73 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH \nSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH \nStorage: -20 ?C or below \n \nLeumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective ?-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form., Echelon
Molecular Weight:: 3525.73
Sequence:: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket