Leumorphin (human) (Preproenkephalin B 226-254)

Product Sizes

0.5 mg

£304.00

ECH-271-35-0.5MG

1 mg

£427.00

ECH-271-35-1MG

About this Product

SKU:: ECH-271-35
Extra Details:: Molecular Weight: 3349.65 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH \nSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYSGELFDA-OH \nStorage: -20 ?C or below \n \nLeumorphin is an endogenous opioid peptide which corresponds to the 226-254 fragment of Preproenkephalin B. It is also known as Dynorphin B1-29. Leumorphin is potent and selective ?-opioid receptor agonist., Echelon
Molecular Weight:: 3349.65
Sequence:: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Ser-Gly-Glu-Leu-Phe-Asp-Ala-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket