Parathyroid Hormone (PTH) (3-34), human

Product Sizes

0.5 mg

£370.00

ECH-231-46-0.5MG

1 mg

£523.00

ECH-231-46-1MG

About this Product

SKU:: ECH-231-46
Extra Details:: Molecular Weight: 3929.06 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH \nSequence (1-letter): SEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH \nStorage: -20 ?C or below \n \nParathyroid Hormone (PTH) regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium. Measuring serum or plasma PTH levels is important for patients in chronic renal failure. Synthetic N-terminal truncated PTH peptides [e.g. PTH(2?34), PTH(3?34) and PTH(7?84)] do not cross?react with the detection antibodies used in second?generation PTH assays., Echelon
Molecular Weight:: 3929.06
Sequence:: Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket