Parathyroid Hormone (PTH) (1-34), human
Product Sizes
0.5 mg
£304.00
ECH-231-40-0.5MG
1 mg
£427.00
ECH-231-40-1MG
About this Product
- SKU:
- ECH-231-40
- CAS Number:
- 52232-67-4
- Extra Details:
- CAS Number: 52232-67-4 \nMolecular Weight: 4115.16 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH \nSequence (1-letter): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH \nStorage: -20 ?C or below \n \nPTH (1-34) is a bioactive fragment of the full length Parathyroid Hormone. PTH regulates serum calcium levels through its effects in the kidney, intestines, and bones. When serum calcium levels are low, PTH is secreted by the chief cells of the parathyroid gland, stimulating osteoclast activity and bone resorption thus the release of calcium., Echelon
- Molecular Weight:
- 4115.16
- Sequence:
- Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH \n
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C
- Supplier:
- Echelon Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Manufacturer's Data Sheet:https://www.echelon-inc.com/product/parathyroid-hormone-pth-1-34-human/


