Calcitonin, human, cyclic

Product Sizes

1 mg

£304.00

ECH-231-25-1MG

5 mg

£948.00

ECH-231-25-5MG

About this Product

SKU:: ECH-231-25
CAS Number:: 21215-62-3
Extra Details:: CAS Number: 21215-62-3 \nMolecular Weight: 3417.6 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 [Cys1-Cys7] \nSequence (1-letter): CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 \nStorage: -20 ?C or below \n \nCalcitonin is a peptide hormone which reduces levels of blood calcium (Ca2+) in opposition of the parathyroid hormone (PTH). It is formed by the proteolytic cleavage of a larger prepropeptide and is excreted by parafollicular cells of the thyroid gland. It is not a significant factor in humans for calcium homeostasis unlike other animals., Echelon
Molecular Weight:: 3417.6
Sequence:: Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 [Cys1-Cys7] \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket