Calcitonin Gene Related Peptide II (8-37), human / Beta CGRP

Product Sizes

0.5 mg

£348.00

ECH-231-22-0.5MG

1 mg

£481.00

ECH-231-22-1MG

About this Product

SKU:: ECH-231-22
CAS Number:: 119911-68-1
Extra Details:: CAS Number: 119911-68-1 \nMolecular Weight: 3128.71 \nSalt Form: TFA \nPurity: >95% \nSequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 \nSequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 \nStorage: -20 ?C or below \n \nCalcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors. \nCalcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP-?) and CGRP II (CGRP-?), Echelon
Molecular Weight:: 3128.71
Sequence:: Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket