Brain Natriuretic Peptide (BNP) (1-32), human / Brain ANP (1-32), human

Product Sizes

0.5 mg

£413.00

ECH-152-52-0.5MG

1 mg

£644.00

ECH-152-52-1MG

About this Product

SKU:: ECH-152-52
CAS Number:: 124584-08-3
Extra Details:: CAS Number: 124584-08-3 \nMolecular Weight: 3463.76 \nSalt Form: TFA \nPurity: >90% \nSequence (3-letter): Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26] \nSequence (1-letter): SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH \nStorage: -20 ?C or below \n \nBrain Natriuretic Peptide (BNP) (1-32) is a bioactive fragment of the 108-aa inactive precursor pro-BNP. Like all natriuretic peptides, BNP (1-32) has an important role in cardiac homeostasis. It binds to the NPR-A receptor and its actions include vasodilation and inhibition of the renal-angiotensin-aldosterone sysntem (RAAS)., Echelon
Molecular Weight:: 3463.76
Sequence:: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH [Cys10-Cys26] \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket