Urodilatin

Product Sizes

0.5 mg

£359.00

ECH-151-30-0.5MG

1 mg

£620.00

ECH-151-30-1MG

About this Product

SKU:: ECH-151-30
CAS Number:: 115966-23-9
Extra Details:: CAS Number: 115966-23-9 \nMolecular Weight: 3505.7 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH \nSequence (1-letter): TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH \nStorage: -20 ?C or below \n \nUrodilatin is a cardiovascular hormone which causes sodium excretion in urine (natriuresis) by increasing renal blood flow. It is secreted in the kidney in response to increasing mean arterial pressure., Echelon
Molecular Weight:: 3505.7
Sequence:: Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket