ACTH (1-39), rat

Product Sizes

1 mg

£523.00

ECH-115-10-1MG

About this Product

SKU:: ECH-115-10
CAS Number:: 77465-10-2
Extra Details:: CAS Number: 77465-10-2 \nMolecular Weight: 4579.33 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH \nSequence (1-letter): SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH \nStorage: -20 ?C or below \n \nACTH (1-39), full name adenocorticotropic hormone, is a peptide hormone also known as corticotropin. ACTH is secreted by the anterior pituitary gland and is often produced in response to stress. ACTH controls the release of glucocorticoid hormones and enhances the transcription of mitochondial genes for oxidative phosphorylation. ACTH is formed by cleavage of POMC (proopimelanocortin). The rat homolog is 95% identical to the human peptide., Echelon
Molecular Weight:: 4579.33
Sequence:: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket