ACTH (7-38), human / Corticotropin Inhibiting Peptide (7-38), human

Product Sizes

1 mg

£338.00

ECH-111-45-1MG

5 mg

£1134.00

ECH-111-45-5MG

About this Product

SKU:: ECH-111-45
CAS Number:: 68563-24-6
Extra Details:: CAS Number: 68563-24-6 \nMolecular Weight: 3656.92 \nSalt Form: TFA \nPurity: >96% \nSequence (3-letter): Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH \nSequence (1-letter): FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE-OH \nStorage: -20 ?C or below \n \nACTH (7-38) or Corticotropin Inhibiting Peptide (CIP) (7-38) is a fragment of Adrenocorticotropic Hormone which inhibits ACTH stimulated adenylate cyclase. It can acts as an antagonist of ACTH receptors., Echelon
Molecular Weight:: 3656.92
Sequence:: Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH \n
Shipping Conditions:: Ambient
Storage Conditions:: -20[o]C
Supplier:: Echelon Biosciences
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides

Basket