Recombinant Human Metal cation symporter ZIP14 (SLC39A14), partial
Product Sizes
20 ug
£412.00
CSB-YP617996HU1-20UG
100 ug
£775.00
CSB-YP617996HU1-100UG
1 mg
£3307.00
CSB-YP617996HU1-1MG
About this Product
- SKU:
- CSB-YP617996HU1
- Additional Names:
- LIV-1 subfamily of ZIP zinc transporter 4;LZT-Hs4;Solute carrier family 39 member 14;Zrt- and Irt-like protein 14;ZIP-14|Recombinant Human SLC39A14 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 15.3 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12935863/


