Recombinant Human RING-box protein 2 (RNF7)
Product Sizes
20 ug
£280.00
CSB-YP019897HU-20UG
100 ug
£526.00
CSB-YP019897HU-100UG
1 mg
£2247.00
CSB-YP019897HU-1MG
About this Product
- SKU:
- CSB-YP019897HU
- Additional Names:
- CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein|Recombinant Human RNF7 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 14.6 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/11029990/


