Recombinant Human Insulin (INS), partial
Product Sizes
100 mg
£253.00
CSB-YP011742HU-WD-100MG
1 g
£1051.00
CSB-YP011742HU-WD-1G
About this Product
- SKU:
- CSB-YP011742HU-WD
- Additional Names:
- Insulin; INS; IDDM; ILPR; IRDN; MODY10|Recombinant Human Insulin protein, partial
- Buffer:
- Lyophilized from a 0.2 um filtered solution(It is recommended to redissolve in sterile 0.01 M HCl at a concentration of not less than 1mg/mL.)
- Molecular Weight:
- 5.8 kDa
- Physical State:
- Lyophilized
- Purity:
- >95%
- Sequence:
- GIVEQCCTSICSLYQLENYCN&FVNQHLCGSHLVEALYLVCGERGFFYTPKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12938203/
