Recombinant Human Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)
Product Sizes
20 ug
£251.00
CSB-RP119544H-20UG
100 ug
£468.00
CSB-RP119544H-100UG
1 mg
£2025.00
CSB-RP119544H-1MG
About this Product
- SKU:
- CSB-RP119544H
- Additional Names:
- Head and neck tumor and metastasis-related protein;MDC-3.13NF-kappa-B-inducible DED-containing protein ;NDEDSCC-S2TNF-induced protein GG2-1|Recombinant Human TNFAIP8 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 49.9 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12549970/
