Recombinant Human Immunoglobulin superfamily member 11 (IGF1R), partial
Product Sizes
20 ug
£145.00
CSB-MP691547HU-20UG
100 ug
£287.00
CSB-MP691547HU-100UG
1 mg
£1762.00
CSB-MP691547HU-1MG
About this Product
- SKU:
- CSB-MP691547HU
- Additional Names:
- IgSF11;Brain and testis-specific immunoglobulin superfamily protein;Bt-IGSF;V-set and immunoglobulin domain-containing protein 3|Recombinant Human IGSF11 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 24.6 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12942586/


