Recombinant Human E3 ubiquitin-protein ligase CHIP (STUB1)
Product Sizes
20 ug
£204.00
CSB-EP892480HU-20UG
100 ug
£339.00
CSB-EP892480HU-100UG
1 mg
£1296.00
CSB-EP892480HU-1MG
About this Product
- SKU:
- CSB-EP892480HU
- Additional Names:
- Antigen NY-CO-7;CLL-associated antigen KW-8;Carboxy terminus of Hsp70-interacting protein;RING-type E3 ubiquitin transferase CHIP;STIP1 homology and U box-containing protein 1|Recombinant Human STUB1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 41.8 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12944182/


