Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), Partial
Product Sizes
20 ug
£342.00
CSB-EP890936HU2B0-A-20UG
100 ug
£646.00
CSB-EP890936HU2B0-A-100UG
1 mg
£2756.00
CSB-EP890936HU2B0-A-1MG
About this Product
- SKU:
- CSB-EP890936HU2B0-A
- Additional Names:
- hASC;Caspase recruitment domain-containing protein 5;PYD and CARD domain-containing protein;Target of methylation-induced silencing 1|Recombinant Human PYCARD protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 17.4 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- AAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12936524/
