Recombinant Human Sodium- and chloride-dependent neutral and basic amino acid transporter B (0+) (SLC6A14), partial
Product Sizes
20 ug
£261.00
CSB-EP890764HU-20UG
100 ug
£448.00
CSB-EP890764HU-100UG
1 mg
£1746.00
CSB-EP890764HU-1MG
About this Product
- SKU:
- CSB-EP890764HU
- Additional Names:
- Amino acid transporter ATB0+;Solute carrier family 6 member 14|Recombinant Human SLC6A14 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 13.3 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12942218/


