Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RPB5)
Product Sizes
20 ug
£434.00
CSB-EP889203KAN-20UG
100 ug
£815.00
CSB-EP889203KAN-100UG
1 mg
£2756.00
CSB-EP889203KAN-1MG
About this Product
- SKU:
- CSB-EP889203KAN
- Additional Names:
- Recombinant Kluyveromyces marxianus RPB5 protein|RPB5; DNA-directed RNA polymerases I; II; and III subunit RPABC1; RNA polymerases I; II; and III subunit ABC1
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 29.0 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12525929/
