Recombinant Monkeypox virus Envelope protein A28 homolog (A30L), partial
Product Sizes
20 ug
£434.00
CSB-EP848659MHV-20UG
100 ug
£815.00
CSB-EP848659MHV-100UG
1 mg
£2756.00
CSB-EP848659MHV-1MG
About this Product
- SKU:
- CSB-EP848659MHV
- Additional Names:
- (Protein A30)|Recombinant Monkeypox virus A30L protein, partial
- Buffer:
- tris/pbs-based buffer
- Extra Details:
- Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
- Molecular Weight:
- 18.2 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
- Shipping Conditions:
- Blue Ice
- Source:
- E.coli
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12933898/


