Recombinant Human V-set and transmembrane domain-containing protein 2-like protein (VSTM2L)
Product Sizes
20 ug
£251.00
CSB-EP842721HU-20UG
100 ug
£468.00
CSB-EP842721HU-100UG
1 mg
£2025.00
CSB-EP842721HU-1MG
About this Product
- SKU:
- CSB-EP842721HU
- Additional Names:
- C20orf102; dJ1118M15.2; Uncharacterized protein C20orf102 precursor; V set and transmembrane domain containing 2 like; V set and transmembrane domain containing protein 2 like protein; V-set and transmembrane domain-containing protein 2-like protein; VSTM 2L; Vstm2l; VTM2L_HUMAN|Recombinant Human VSTM2L protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 36.0 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1031246/
