Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)
Product Sizes
20 ug
£251.00
CSB-EP819458HU-20UG
100 ug
£468.00
CSB-EP819458HU-100UG
1 mg
£2025.00
CSB-EP819458HU-1MG
About this Product
- SKU:
- CSB-EP819458HU
- Additional Names:
- 1700007B22Rik; AI850911; Fank1; FANK1_HUMAN; Fibronectin type 3 and ankyrin repeat domains 1; Fibronectin type 3 and ankyrin repeat domains protein 1; Fibronectin type III and ankyrin repeat domains 1; HSD13|Recombinant Human FANK1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 54.3 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- MEPQKIMPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHTYGIIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTREPISSEHLHRAVSVNDEDLLVRILQGGRVKVDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTALHWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVVSLLEERKKKQRPKKSCVC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/868324/
