Recombinant Human Cell division cycle and apoptosis regulator protein 1 (CCAR1), partial
Product Sizes
20 ug
£342.00
CSB-EP816898HU-20UG
100 ug
£646.00
CSB-EP816898HU-100UG
1 mg
£2756.00
CSB-EP816898HU-1MG
About this Product
- SKU:
- CSB-EP816898HU
- Additional Names:
- Cell cycle and apoptosis regulatory protein 1;CARP-1;Death inducer with SAP domain|Recombinant Human CCAR1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 34.3 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPPAVLQPIAPQTTFGVQTQPQPQSLLQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12935693/
