Recombinant Human E3 ubiquitin-protein ligase HUWE1 (HUWE1), partial
Product Sizes
20 ug
£434.00
CSB-EP773604HU-20UG
100 ug
£815.00
CSB-EP773604HU-100UG
1 mg
£2756.00
CSB-EP773604HU-1MG
About this Product
- SKU:
- CSB-EP773604HU
- Additional Names:
- (ARF-binding protein 1)(ARF-BP1)(HECT, UBA and WWE domain-containing protein 1)(HECT-type E3 ubiquitin transferase HUWE1)(Homologous to E6AP carboxyl terminus homologous protein 9)(HectH9)(Large structure of UREB1)(LASU1)(Mcl-1 ubiquitin ligase E3)(Mule)(Upstream regulatory element-binding protein 1)(URE-B1)(URE-binding protein 1)|Recombinant Human HUWE1 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 50.7 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12932768/
