Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1)
Product Sizes
20 ug
£342.00
CSB-EP773600HU-20UG
100 ug
£646.00
CSB-EP773600HU-100UG
1 mg
£2756.00
CSB-EP773600HU-1MG
About this Product
- SKU:
- CSB-EP773600HU
- Additional Names:
- EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein phosphatase 1 regulatory subunit 147; SPRE1_HUMAN; SPRED 1; Spred-1; spred1; Sprouty related EVH1 domain containing 1; sprouty related EVH1 domain containing protein 1; Sprouty related protein 1 with EVH 1 domain; Sprouty-related; Suppressor of Ras/MAPK activation|Recombinant Human SPRED1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 70.3 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12344708/


