Recombinant Drosophila melanogaster Sterile alpha and TIR motif-containing protein 1 (Ect4) (A386L,H392R,T433V,T434A,L595S,A596D,H599Q), partial
Product Sizes
20 ug
£434.00
CSB-EP764228DLU1-M-20UG
100 ug
£815.00
CSB-EP764228DLU1-M-100UG
1 mg
£2756.00
CSB-EP764228DLU1-M-1MG
About this Product
- SKU:
- CSB-EP764228DLU1-M
- Additional Names:
- (NADase sarm1)(Sterile alpha and TIR motif-containing protein 1)(Tir-1 homolog)|Recombinant Drosophila melanogaster Ect4 protein (Mutant type), partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 37.0 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >85%
- Sequence:
- KSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGET
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12932344/
-SDS.jpg?width=200)
-SDS.jpg?width=850)
