Recombinant Human ALK and LTK ligand 1 (ALKAL1)
Product Sizes
20 ug
£342.00
CSB-EP757795HU-20UG
100 ug
£646.00
CSB-EP757795HU-100UG
1 mg
£2756.00
CSB-EP757795HU-1MG
About this Product
- SKU:
- CSB-EP757795HU
- Additional Names:
- ALKAL1; FAM150A; UNQ9433/PRO34745ALK and LTK ligand 1; Augmentor beta; AUG-beta; Protein FAM150A|Recombinant Human ALKAL1 protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 25.5 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12304060/
