Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Rev (rev)
Product Sizes
20 ug
£434.00
CSB-EP748326HDAH-20UG
100 ug
£815.00
CSB-EP748326HDAH-100UG
1 mg
£2756.00
CSB-EP748326HDAH-1MG
About this Product
- SKU:
- CSB-EP748326HDAH
- Additional Names:
- ART/TRS (Anti-repression transactivator) (Regulator of expression of viral proteins)|Recombinant Human immunodeficiency virus type 1 group M subtype C rev protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 38.7 kda
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- MAGRSGDSDEELLKAVRIIKILYQSNPYPTPEGTRQARRNRRRRWRARQRQIHTLSERILSNFLGRPAEPVPLQLPPLERLNLDCSEDSGTSGTQQSQGTTEGVGNP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12928358/
