Recombinant Human Metal cation symporter ZIP14 (SLC39A14), partial
Product Sizes
20 ug
£342.00
CSB-EP617996HU1-20UG
100 ug
£646.00
CSB-EP617996HU1-100UG
1 mg
£2756.00
CSB-EP617996HU1-1MG
About this Product
- SKU:
- CSB-EP617996HU1
- Additional Names:
- (LIV-1 subfamily of ZIP zinc transporter 4)(LZT-Hs4)(Solute carrier family 39 member 14)(Zrt- and Irt-like protein 14)(ZIP-14)|Recombinant Human SLC39A14 protein, partial
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 20.8 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12934900/
