Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)
Product Sizes
20 ug
£226.00
CSB-EP356309HKP-20UG
100 ug
£380.00
CSB-EP356309HKP-100UG
1 mg
£1468.00
CSB-EP356309HKP-1MG
About this Product
- SKU:
- CSB-EP356309HKP
- Additional Names:
- ART/TRS;Anti-repression transactivator;Regulator of expression of viral proteins|Recombinant Human immunodeficiency virus type 1 group M subtype B rev protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 20.0 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >95%
- Sequence:
- MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/12943255/


