Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
Product Sizes
20 ug
£434.00
CSB-EP330956CEC-20UG
100 ug
£815.00
CSB-EP330956CEC-100UG
1 mg
£2756.00
CSB-EP330956CEC-1MG
About this Product
- SKU:
- CSB-EP330956CEC
- Additional Names:
- Major pollen allergen Car b 1 isoforms 1A and 1B; Allergen Car b I; allergen Car b 1|Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B protein
- Buffer:
- tris/pbs-based buffer
- Molecular Weight:
- 21.3 kDa
- Physical State:
- Liquid or Lyophilized powder
- Purity:
- >90%
- Sequence:
- GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles.
- Supplier:
- Cusabio
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.cusabio.com/datasheet/1030432/


